Anti-Prostaglandin E Receptor EP4 antibody
| Name | Anti-Prostaglandin E Receptor EP4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133170 |
| Prices | $378.00 |
| Sizes | 500 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P ICC/IF |
| Species Reactivities | Mouse, Rat, Sheep, Human |
| Antigen | Synthetic peptide: GSGRAGPAPKGSSLQVTFPSETLNLSEKCI conjugated to KLH, corresponding to C-terminal amino acids 459-488 of Human Prostaglandin E Receptor EP4 |
| Description | Rabbit Polyclonal |
| Gene | PTGER4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemical analysis of paraffin embedded Human prostate tissue labelling Prostaglandin E Receptor EP4 with ab133170 antibody at a concentration of 5 µg/ml, followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.