| Name | Anti-Prostaglandin E Receptor EP4 antibody (Phycoerythrin) |
|---|---|
| Supplier | Abcam |
| Catalog | ab133716 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | FC |
| Species Reactivities | Mouse, Rat, Sheep, Human, Rabbit, Chimpanzee, Monkey, Monkey |
| Antigen | Synthetic peptide: GSGRAGPAPKGSSLQVTFPSETLNLSEKCI , corresponding to C terminal amino acids 459-488 of Human Prostaglandin E Receptor EP4 |
| Description | Rabbit Polyclonal |
| Gene | PTGER4 |
| Conjugate | Phycoerythrin |
| Supplier Page | Shop |