Anti-PSMG1 antibody
| Name | Anti-PSMG1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83527 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal region amino acids 239-288 ( VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT ) of Human PSMG1 (NP_003711) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | PSMG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PSMG1 antibody (ab83527) at 1 µg/ml (in 5% skim milk/ PBS) + Human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution