Name | Anti-PTBP2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab94696 |
Prices | $376.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 108-157 ( ITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQ ) of Human PTBP2 (NP_067013) |
Description | Rabbit Polyclonal |
Gene | PTBP2 |
Conjugate | Unconjugated |
Supplier Page | Shop |