| Name | Anti-PTHLH antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab14166 |
| Prices | $0.00 |
| Sizes | 50 µl |
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | RIA |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide: KNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP , corresponding to amino acids 53-86 of Human PTHLH |
| Blocking Peptide | Human PTHLH peptide |
| Description | Goat Polyclonal |
| Gene | PTHLH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |