Anti-PURA antibody
| Name | Anti-PURA antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86534 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Guinea Pig, Bovine, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 ( GGGGGGGSGGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRF ) of Human PURA (NP_005850) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | PURA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PURA antibody (ab86534) at 1 µg/ml + HepG2 Cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution