Anti-RAG2 antibody
| Name | Anti-RAG2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122956 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Dog |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 468-517 (HLSAGSNKYYCNEHVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTP A) of Human RAG2 (NP_000527 |
| Description | Rabbit Polyclonal |
| Gene | RAG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RAG2 antibody (ab122956) at 1 µg/ml + Human fetal lung lysate at 10 µg