Anti-RALB antibody
| Name | Anti-RALB antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102093 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYV E) of Human RALB (NP_002872) |
| Description | Rabbit Polyclonal |
| Gene | RALB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RALB antibody (ab102093) at 1 µg/ml + ACHN cell lysate at 10 µg