Anti-RASSF1C antibody

Name Anti-RASSF1C antibody
Supplier Abcam
Catalog ab24419
Prices $370.00
Sizes 100 µl
Host Mouse
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Mouse, Human, Rat
Antigen Fusion protein: EAPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQ , corresponding to amino acids 5/49 of Human RASSF1C Run BLAST with Run BLAST with
Description Mouse Polyclonal
Gene RASSF1
Conjugate Unconjugated
Supplier Page Shop

Product images


Product References