Anti-RBJ antibody
| Name | Anti-RBJ antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98024 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 ( CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR ) of Human RBJ (NP_057628) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | DNAJC27 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RBJ antibody (ab98024) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human Fetal Kidney Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution