Anti-RECQL5 antibody
| Name | Anti-RECQL5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab91422 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB IP |
| Species Reactivities | Human, Chimpanzee, Ape, Orangutan |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 (MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVF V) of Human RECQL5 (NP_004250 |
| Description | Rabbit Polyclonal |
| Gene | RECQL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast carcinoma tissue labelling RECQL5 with ab91422 at 1/1000 (1µg/ml). Detection: DAB.
All lanes : Anti-RECQL5 antibody (ab91422) at 0.1 µg/mlLane 1 : HeLa cell lysate at 50 µgLane 2 : HeLa cell lysate at 15 µgLane 3 : HeLa cell lysate at 5 µg
SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91422. 20% of the immunoprecipitate was loaded per lane, and probed with ab91422 at 1µg/ml (lane 1) or a control IgG (lane2). Detection: chemoluminescence with an exposure time of 10 seconds.