Anti-Renalase antibody
| Name | Anti-Renalase antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128261 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 203-252 ( GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV ) of Mouse Renalase (NP_001161290) |
| Description | Rabbit Polyclonal |
| Gene | RNLS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Renalase antibody (ab128261) at 1 µg/ml + Mouse heart lysate at 10 µg