Anti-RHBDF1 antibody
| Name | Anti-RHBDF1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81342 |
| Prices | $379.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (ALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQP K) of Human RHBDF1 (NP_071895) |
| Description | Rabbit Polyclonal |
| Gene | RHBDF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RHBDF1 antibody (ab81342) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysateSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution