Anti-RHOD antibody
| Name | Anti-RHOD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab80537 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region between N terminal residues 2 and 51 (TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTV F) of human RHOD (NP_055393) |
| Description | Rabbit Polyclonal |
| Gene | RHOD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RHOD antibody (ab80537) at 1 µg/ml (in 5% skim milk / PBS buffer) + RHOD transfected 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution