Anti-SAE2 / UBA2 antibody
| Name | Anti-SAE2 / UBA2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab22104 |
| Prices | $378.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Chicken, Human, Xenopus, Zebrafish |
| Antigen | Synthetic peptide: ECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPD R , corresponding to amino acids 160/210 of Human SAE2 |
| Description | Rabbit Polyclonal |
| Gene | UBA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SAE2 / UBA2 antibody (ab22104) at 1 µg/ml + HeLa cell lysateObserved band size : 71 kDa (why is the actual band size different from the predicted?)Additional bands at : 110 kDa. We are unsure as to the identity of these extra bands.