Anti-Securin antibody
| Name | Anti-Securin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94689 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Horse, Cat, Pig, Chimpanzee |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 ( ATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFD ) of Human Securin (NP_004210) |
| Description | Rabbit Polyclonal |
| Gene | PTTG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
