Anti-SGEF antibody

Name Anti-SGEF antibody
Supplier Abcam
Catalog ab98848
Prices $370.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Bovine, Cat, Pig, Yeast
Antigen Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLIT D) of Human SGEF (NP_056410)
Description Rabbit Polyclonal
Gene ARHGEF26
Conjugate Unconjugated
Supplier Page Shop

Product images