Name | Anti-SGEF antibody |
---|---|
Supplier | Abcam |
Catalog | ab98848 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Bovine, Cat, Pig, Yeast |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLIT D) of Human SGEF (NP_056410) |
Description | Rabbit Polyclonal |
Gene | ARHGEF26 |
Conjugate | Unconjugated |
Supplier Page | Shop |