Anti-SGK196 antibody
| Name | Anti-SGK196 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81537 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 72-121 (LSCEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFL H) of Human SGK196, NP_115613 |
| Description | Rabbit Polyclonal |
| Gene | POMK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SGK196 antibody (ab81537) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution