Anti-SIA8D antibody
| Name | Anti-SIA8D antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133921 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 394-443 ( GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA ) of rat SIA8D (NP_446366) |
| Description | Rabbit Polyclonal |
| Gene | ST8SIA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SIA8D antibody (ab133921) at 1 µg/ml + Rat testis lysate at 10 µg