Name | Anti-SIA8D antibody |
---|---|
Supplier | Abcam |
Catalog | ab133921 |
Prices | $359.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Pig, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 394-443 ( GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA ) of rat SIA8D (NP_446366) |
Description | Rabbit Polyclonal |
Gene | ST8SIA4 |
Conjugate | Unconjugated |
Supplier Page | Shop |