Anti-SIRT5 antibody
| Name | Anti-SIRT5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86274 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Rabbit, Pig |
| Antigen | Synthetic peptide corresponding to a region within the internal amino acids 179-228 (ICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD P) of Human SIRT5 (NP_036373) |
| Description | Rabbit Polyclonal |
| Gene | SIRT5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SIRT5 antibody (ab86274) at 1 µg/ml (5% skim milk/ PBS buffer) + fetal heart lysate at 10 µg with gel concentration: 12%SecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human small intestine labelling SIRT5 with ab86274.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human vessels labelling SIRT5 with ab86274.