Anti-SKAP55 antibody
| Name | Anti-SKAP55 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab19377 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IP WB |
| Species Reactivities | Human, Rat |
| Antigen | Immunogen corresponds to amino acids 2-105 of Human SKAP55: QAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKAR YYWDFQPQG |
| Description | Rabbit Polyclonal |
| Gene | SKAP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-SKAP55 antibody (ab19377) at 1/500 dilutionLane 1 : Human T cell lysateLane 2 : Human platelet lysateLysates/proteins at 20 µg per lane.SecondaryGoat polyclonal to Rabbit IgG conjugated to Odyssey IR-Dye 800 at 1/50000 dilutionPerformed under reducing conditions.