Anti-SMC5 antibody
| Name | Anti-SMC5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab18038 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Mouse, Human, Rat, Horse, Guinea Pig, Bovine, Dog, Pig, Chimpanzee, Ferret, Monkey, Ape, Orangutan |
| Antigen | Synthetic peptide: FFITPKLLQNLPYSEKMTVLFVYNGPHMLEP , corresponding to C terminal amino acids 1050-1101 of Human SMC5, using the numbering given in TrEMBL entry Q8IY18 (GeneID 23137) |
| Description | Rabbit Polyclonal |
| Gene | SMC5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Product References
Smc5/6-mediated regulation of replication progression contributes to chromosome - Smc5/6-mediated regulation of replication progression contributes to chromosome
Gallego-Paez LM, Tanaka H, Bando M, Takahashi M, Nozaki N, Nakato R, Shirahige K, Hirota T. Mol Biol Cell. 2014 Jan;25(2):302-17.
Identification of a novel proliferation-related protein, WHSC1 4a, in human - Identification of a novel proliferation-related protein, WHSC1 4a, in human
Li J, Yin C, Okamoto H, Mushlin H, Balgley BM, Lee CS, Yuan K, Ikejiri B, Glasker S, Vortmeyer AO, Oldfield EH, Weil RJ, Zhuang Z. Neuro Oncol. 2008 Feb;10(1):45-51.