Name | Anti-Smek1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab102096 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 624-673 (YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDA R) of Human Smek1 (NP_115949) |
Description | Rabbit Polyclonal |
Gene | SMEK1 |
Conjugate | Unconjugated |
Supplier Page | Shop |