Name | Anti-SNT2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab90030 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide designed within residues: FPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGP , corresponding to amino acids 360-409 of Human SNT2 (NP_006644) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | FRS3 |
Conjugate | Unconjugated |
Supplier Page | Shop |