Anti-SNT2 antibody

Name Anti-SNT2 antibody
Supplier Abcam
Catalog ab90030
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig
Antigen Synthetic peptide designed within residues: FPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGP , corresponding to amino acids 360-409 of Human SNT2 (NP_006644) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene FRS3
Conjugate Unconjugated
Supplier Page Shop

Product images