Anti-Sphingomyelin Synthase 2 antibody
| Name | Anti-Sphingomyelin Synthase 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87214 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 72 - 121 ( FPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYI ) of Human Sphingomyelin Synthase 2 (NP_689834) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SGMS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Sphingomyelin Synthase 2 antibody (ab87214) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution