Anti-SUV3L1 antibody
| Name | Anti-SUV3L1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85598 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 72-121 of Human SUV3L1; QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH ; (NP_0031620) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SUPV3L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SUV3L1 antibody (ab85598) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal muscle lysate (Human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution