Anti-TAP1 antibody
| Name | Anti-TAP1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83817 |
| Prices | $378.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 504-553 ( LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL ) of Human TAP1 (NP_000584) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TAP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lung tissue labelling TAP1 with ab83817 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of alveolar type I and II cells. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - TAP1. Right - Merge.
Anti-TAP1 antibody (ab83817) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution