Anti-TCF7L1 antibody
| Name | Anti-TCF7L1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82690 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Bovine, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 71-120 (ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP G) of Human TCF7L1 (NP_112573) |
| Description | Rabbit Polyclonal |
| Gene | TCF7L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TCF7L1 antibody (ab82690) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution