C9orf46 Antibody

Name C9orf46 Antibody
Supplier Genway Biotech
Catalog GWB-MR466G
Prices $368.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Bovine, Dog, Human, Mouse, Rat
Antigen Synthetic Peptide within the following region: GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Purity/Format Lyophilized powder. Add 50 ul of distilled water. Final anti-C9orf46 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
Description Rabbit Polyclonal
Gene PLGRKT
Supplier Page Shop