Name | RNF169 Antibody |
---|---|
Supplier | Genway Biotech |
Catalog | GWB-MP503H |
Prices | $368.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Bovine, Dog, Guinea Pig, Horse, Pig, Rabbit |
Antigen | Synthetic Peptide within the following region: DTETGKRKMDEQKKRDEPLVLKTNLERCPARLSDSENEEPSRGQMTQTHR |
Purity/Format | Lyophilized powder. Add 50 ul of distilled water. Final anti-RNF169 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
Description | Rabbit Polyclonal |
Gene | RNF169 |
Supplier Page | Shop |