Name | Prmt7 Antibody |
---|---|
Supplier | Genway Biotech |
Catalog | GWB-MN361A |
Prices | $404.00 |
Sizes | 50 µg |
Clonality | Polyclonal |
Applications | WB |
Antigen | Synthetic Peptide within the following region: GEINDQDRTDHYAQALRTVLLPGSVCLCVSDGSLLSMLAHHLGAEQVFTV |
Purity/Format | Lyophilized powder. Add 50 ul of distilled water. Final anti-Prmt7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. |
Description | Polyclonal |
Gene | Prmt7 |
Supplier Page | Shop |