Anti-TLR5 antibody
| Name | Anti-TLR5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab1654 |
| Prices | $379.00 |
| Sizes | 100 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide: DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ , corresponding to amino acids 151-181 of Human TLR5 |
| Description | Goat Polyclonal |
| Gene | TLR5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry with ab1654 on paraffin section of human spleen
Product References
Increased expression of Toll-like receptor 5 during progression of cervical - Increased expression of Toll-like receptor 5 during progression of cervical
Kim WY, Lee JW, Choi JJ, Choi CH, Kim TJ, Kim BG, Song SY, Bae DS. Int J Gynecol Cancer. 2008 Mar-Apr;18(2):300-5. Epub 2007 Jun 22.
Human intestinal microvascular endothelial cells express Toll-like receptor 5: a - Human intestinal microvascular endothelial cells express Toll-like receptor 5: a
Maaser C, Heidemann J, von Eiff C, Lugering A, Spahn TW, Binion DG, Domschke W, Lugering N, Kucharzik T. J Immunol. 2004 Apr 15;172(8):5056-62.