Anti-TLR5 antibody

• Supplier: Abcam
• Catalog: ab13868
• Prices: $359.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC-P FC
• Species Reactivities: Mouse, Rat, Human
• Antigen: Synthetic peptide: VFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLG E , corresponding to amino acids 300-350 of Human TLR5
• Description: Rabbit Polyclonal
• Gene: TLR5
• Conjugate: Unconjugated

Product images

All lanes : Anti-TLR5 antibody (ab13868) at 2 µg/mlLane 1 : Ramos whole cell lysateLane 2 : Raw whole cell lysateLane 3 : Mouse spleen whole cell lysateLane 4 : Mouse lung whole cell lysateLane 5 : Rat lung whole cell lysate

An isotype control (top) and ab13868 (bottom), at 10 µg/ml, staining TLR5 in Human Stomach tumor tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

Intracellular flow analysis of TLR5 in Balb/c mouse splenocytes using ab13868 at 2 ug/106 cells. Shaded histogram represents cells without antibody; green represents a rabbit IgG isotype control; red represents anti-TLR5 antibody. Goat anti-rabbit PE (ab47646) was used as secondary antibody.