Anti-TLR7 antibody
| Name | Anti-TLR7 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab13732 |
| Prices | $378.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | FC |
| Species Reactivities | Mouse, Human, Rat |
| Antigen | Synthetic peptide: LKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLK N conjugated to KLH, corresponding to amino acids 650-700 of Human TLR7 |
| Description | Rabbit Polyclonal |
| Gene | TLR7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Intracellular staining by FACS analysis of TLR7 in Ramos cells (A) using ab13732 at 1µg/ml. Histogram B shows the rabbit isotype control.