Anti-TRIT1 antibody
| Name | Anti-TRIT1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87166 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 180 - 229 ( HDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILWL ) of Human TRIT1 (NP_060116) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TRIT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TRIT1 antibody (ab87166) at 1 µg/ml + Human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution