Anti-Tubby antibody
| Name | Anti-Tubby antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82689 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Rabbit, Horse |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 0-49 (MGARTPLPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHR R) of Human Tubby (NP_003311) |
| Description | Rabbit Polyclonal |
| Gene | TUB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Tubby antibody (ab82689) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution