Anti-USP22 antibody
| Name | Anti-USP22 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82986 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 71-120 (RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIY D) of Human USP22 (NP_056091) |
| Description | Rabbit Polyclonal |
| Gene | USP22 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-USP22 antibody (ab82986) at 1 µg/ml + Fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution