Anti-VPS37A antibody
| Name | Anti-VPS37A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85843 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | A synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV E) of Human VPS37A (NP_689628) |
| Description | Rabbit Polyclonal |
| Gene | VPS37A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-VPS37A antibody (ab85843) at 1 µg/ml + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution