Name | Anti-VPS37A antibody |
---|---|
Supplier | Abcam |
Catalog | ab85843 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | A synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV E) of Human VPS37A (NP_689628) |
Description | Rabbit Polyclonal |
Gene | VPS37A |
Conjugate | Unconjugated |
Supplier Page | Shop |