Anti-WIPI1 antibody
| Name | Anti-WIPI1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99199 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN ) of Human WIPI1 (NP_060453) |
| Description | Rabbit Polyclonal |
| Gene | WIPI1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-WIPI1 antibody (ab99199) at 1 µg/ml + COLO205 cell lysate at 10 µg