| Name | Anti-YAP1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab22144 |
| Prices | $395.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Fusion protein: MNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQH VRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVP , corresponding to amino acids 73/172 of Human Yes associated protein 1 Run BLAST with Run BLAST with |
| Description | Mouse Polyclonal |
| Gene | YAP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |