Rabbit anti-Human HMGCLL1 polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-19393
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human, Mouse, Rat, Rabbit, Horse, Bovine
• Antigen: Synthetic peptide corresponding to a region within N terminal amino acids 2-51 (GNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI V) of Human HMGCLL1 (NP_001035865).
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: HMGCLL1
• Conjugate: Unconjugated