Anti-RNLS (aa 203-252) polyclonal antibody

Name Anti-RNLS (aa 203-252) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-28423
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Mouse
Antigen Synthetic peptide corresponding to a region within internal amino acids 203-252 (GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFG V) of Mouse Renalase (NP_001161290).
Description Rabbit Polyclonal
Gene Rnls
Conjugate Unconjugated
Supplier Page Shop