| Name | Anti-CCL4 / SYCA4 Antibody (aa27-92) |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C71941 |
| Prices | $650.00 |
| Sizes | 50 µg |
| Host | Chicken |
| Clonality | Polyclonal |
| Isotype | IgY |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | CCL4 / SYCA4 antibody was raised against synthetic peptide: GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN, corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta. Percent identity by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Horse (97%); Panda (90%); Bovine, Dog, Pig (87%); Rat, Hamster, Rabbit (84%); Mouse (81%). |
| Purity/Format | Immunoaffinity purified |
| Description | Chicken Polyclonal |
| Gene | CCL4 |
| Supplier Page | Shop |