Claudin-7 Antibody

Name Claudin-7 Antibody
Supplier Novus Biologicals
Catalog NBP1-85683
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS
Purity/Format Immunogen affinity purified
Blocking Peptide Claudin-7 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CLDN7
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.