C16orf73, Polyclonal Antibody

Name C16orf73, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303362
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C16orf73 antibody was raised using the middle region of C16orf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH
Purity/Format Affinity purified
Description C16orf73 antibody
Gene MEIOB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.