| Name | Calsyntenin 3, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302639 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA |
| Purity/Format | Affinity purified |
| Description | Calsyntenin 3 antibody |
| Gene | CLSTN3 |
| Supplier Page | Shop |