HS3ST3B1, Polyclonal Antibody

Name HS3ST3B1, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303391
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HS3ST3B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR
Purity/Format Affinity purified
Description HS3ST3B1 antibody
Gene HS3ST3B1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.