| Name | NOLA3, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302160 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK |
| Purity/Format | Affinity purified |
| Description | NOLA3 antibody |
| Gene | NOP10 |
| Supplier Page | Shop |