OLAH, Polyclonal Antibody

Name OLAH, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303043
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
Purity/Format Affinity purified
Description OLAH antibody
Gene OLAH
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.