| Name | OLAH, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301777 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OLAH antibody was raised using the N terminal of OLAH corresponding to a region with amino acids MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC |
| Purity/Format | Affinity purified |
| Description | OLAH antibody |
| Gene | OLAH |
| Supplier Page | Shop |